Loading...
Loading...
Design novel protein therapeutics (binders, enzymes, scaffolds) using AI-guided de novo design. Uses RFdiffusion for backbone generation, ProteinMPNN for sequence design, ESMFold/AlphaFold2 for validation. Use when asked to design protein binders, therapeutic proteins, or engineer protein function.
npx skill4agent add mims-harvard/tooluniverse tooluniverse-protein-therapeutic-design[TARGET]_protein_design_report.md[Designing...][TARGET]_designed_sequences.fasta[TARGET]_top_candidates.csv### Design: Binder_001
**Sequence**: MVLSPADKTN...
**Length**: 85 amino acids
**Target**: PD-L1 (UniProt: Q9NZQ7)
**Method**: RFdiffusion → ProteinMPNN → ESMFold validation
**Quality Metrics**:
| Metric | Value | Interpretation |
|--------|-------|----------------|
| pLDDT | 88.5 | High confidence |
| pTM | 0.82 | Good fold |
| ProteinMPNN score | -2.3 | Favorable |
| Predicted binding | Strong | Based on interface pLDDT |
*Source: NVIDIA NIM via `NvidiaNIM_rfdiffusion`, `NvidiaNIM_proteinmpnn`, `NvidiaNIM_esmfold`*| Tool | Purpose | API Key Required |
|---|---|---|
| Backbone generation | Yes |
| Sequence design | Yes |
| Fast structure validation | Yes |
| High-accuracy validation | Yes |
| Sequence embeddings | Yes |
| Tool | WRONG Parameter | CORRECT Parameter |
|---|---|---|
| | |
| | |
| | |
Phase 1: Target Characterization
├── Get target structure (PDB, EMDB cryo-EM, or AlphaFold)
├── Identify binding epitope
├── Analyze existing binders
├── Check EMDB for membrane protein structures (NEW)
└── OUTPUT: Target profile
↓
Phase 2: Backbone Generation (RFdiffusion)
├── Define design constraints
├── Generate multiple backbones
├── Filter by geometry quality
└── OUTPUT: Candidate backbones
↓
Phase 3: Sequence Design (ProteinMPNN)
├── Design sequences for each backbone
├── Sample multiple sequences per backbone
├── Score by ProteinMPNN likelihood
└── OUTPUT: Designed sequences
↓
Phase 4: Structure Validation
├── Predict structure (ESMFold/AlphaFold2)
├── Compare to designed backbone
├── Assess fold quality (pLDDT, pTM)
└── OUTPUT: Validated designs
↓
Phase 5: Developability Assessment
├── Aggregation propensity
├── Expression likelihood
├── Immunogenicity prediction
└── OUTPUT: Developability scores
↓
Phase 6: Report Synthesis
├── Ranked candidate list
├── Experimental recommendations
├── Next steps
└── OUTPUT: Final reportdef get_target_structure(tu, target_id):
"""Get target structure from PDB, EMDB, or predict."""
# Try PDB first (X-ray/NMR)
pdb_results = tu.tools.PDB_search_by_uniprot(uniprot_id=target_id)
if pdb_results:
# Get highest resolution structure
best_pdb = sorted(pdb_results, key=lambda x: x['resolution'])[0]
structure = tu.tools.PDB_get_structure(pdb_id=best_pdb['pdb_id'])
return {'source': 'PDB', 'pdb_id': best_pdb['pdb_id'],
'resolution': best_pdb['resolution'], 'structure': structure}
# Try EMDB for cryo-EM structures (valuable for membrane proteins)
protein_info = tu.tools.UniProt_get_protein_by_accession(accession=target_id)
emdb_results = tu.tools.emdb_search(
query=protein_info['proteinDescription']['recommendedName']['fullName']['value']
)
if emdb_results and len(emdb_results) > 0:
# Get highest resolution cryo-EM entry
best_emdb = sorted(emdb_results, key=lambda x: x.get('resolution', 99))[0]
# Get associated PDB model if available
emdb_details = tu.tools.emdb_get_entry(entry_id=best_emdb['emdb_id'])
if emdb_details.get('pdb_ids'):
structure = tu.tools.PDB_get_structure(pdb_id=emdb_details['pdb_ids'][0])
return {'source': 'EMDB cryo-EM', 'emdb_id': best_emdb['emdb_id'],
'pdb_id': emdb_details['pdb_ids'][0],
'resolution': best_emdb.get('resolution'), 'structure': structure}
# Fallback to AlphaFold prediction
sequence = tu.tools.UniProt_get_protein_sequence(accession=target_id)
structure = tu.tools.NvidiaNIM_alphafold2(
sequence=sequence['sequence'],
algorithm="mmseqs2"
)
return {'source': 'AlphaFold2 (predicted)', 'structure': structure}def get_cryoem_structures(tu, target_name):
"""Get cryo-EM structures for membrane proteins/complexes."""
# Search EMDB
emdb_results = tu.tools.emdb_search(
query=f"{target_name} membrane OR receptor"
)
structures = []
for entry in emdb_results[:5]:
details = tu.tools.emdb_get_entry(entry_id=entry['emdb_id'])
structures.append({
'emdb_id': entry['emdb_id'],
'resolution': entry.get('resolution', 'N/A'),
'title': entry.get('title', 'N/A'),
'conformational_state': details.get('state', 'Unknown'),
'pdb_models': details.get('pdb_ids', [])
})
return structures### 1.1b Cryo-EM Structures (EMDB)
| EMDB ID | Resolution | PDB Model | Conformation |
|---------|------------|-----------|--------------|
| EMD-12345 | 2.8 Å | 7ABC | Active state |
| EMD-23456 | 3.1 Å | 8DEF | Inactive state |
**Note**: Cryo-EM structures capture physiologically relevant conformations for membrane protein targets.
*Source: EMDB*def identify_epitope(tu, target_structure, epitope_residues=None):
"""Identify or validate binding epitope."""
if epitope_residues:
# User-specified epitope
return {'residues': epitope_residues, 'source': 'user-defined'}
# Find surface-exposed regions
# Use structural analysis to identify potential epitopes
return analyze_surface(target_structure)## 1. Target Characterization
### 1.1 Target Information
| Property | Value |
|----------|-------|
| **Target** | PD-L1 (Programmed death-ligand 1) |
| **UniProt** | Q9NZQ7 |
| **Structure source** | PDB: 4ZQK (2.0 Å resolution) |
| **Binding epitope** | IgV domain, residues 19-127 |
| **Known binders** | Atezolizumab, durvalumab, avelumab |
### 1.2 Epitope Analysis
| Residue Range | Type | Surface Area | Druggability |
|---------------|------|--------------|--------------|
| 54-68 | Loop | 850 Ų | High |
| 115-125 | Beta strand | 420 Ų | Medium |
| 19-30 | N-terminus | 380 Ų | Medium |
**Selected Epitope**: Residues 54-68 (PD-1 binding interface)
*Source: PDB 4ZQK, surface analysis*def generate_backbones(tu, design_params):
"""Generate de novo backbones using RFdiffusion."""
backbones = tu.tools.NvidiaNIM_rfdiffusion(
diffusion_steps=design_params.get('steps', 50),
# Additional parameters depending on design type
)
return backbones| Mode | Use Case | Key Parameters |
|---|---|---|
| Unconditional | De novo scaffold | |
| Binder design | Target-guided binder | |
| Motif scaffolding | Functional motif embedding | |
## 2. Backbone Generation
### 2.1 Design Parameters
| Parameter | Value |
|-----------|-------|
| **Method** | RFdiffusion via NVIDIA NIM |
| **Design mode** | Unconditional scaffold generation |
| **Diffusion steps** | 50 |
| **Number generated** | 10 backbones |
### 2.2 Generated Backbones
| Backbone | Length | Topology | Quality |
|----------|--------|----------|---------|
| BB_001 | 85 aa | 3-helix bundle | Good |
| BB_002 | 92 aa | Beta sandwich | Good |
| BB_003 | 78 aa | Alpha-beta | Good |
| BB_004 | 88 aa | All-alpha | Moderate |
| BB_005 | 95 aa | Mixed | Good |
**Selected for sequence design**: BB_001, BB_002, BB_003, BB_005 (top 4)
*Source: NVIDIA NIM via `NvidiaNIM_rfdiffusion`*def design_sequences(tu, backbone_pdb, num_sequences=8):
"""Design sequences for backbone using ProteinMPNN."""
sequences = tu.tools.NvidiaNIM_proteinmpnn(
pdb_string=backbone_pdb,
num_sequences=num_sequences,
temperature=0.1 # Lower = more conservative
)
return sequences| Parameter | Conservative | Moderate | Diverse |
|---|---|---|---|
| Temperature | 0.1 | 0.2 | 0.5 |
| Sequences per backbone | 4 | 8 | 16 |
| Use case | Validated scaffold | Exploration | Diversity |
## 3. Sequence Design
### 3.1 Design Parameters
| Parameter | Value |
|-----------|-------|
| **Method** | ProteinMPNN via NVIDIA NIM |
| **Temperature** | 0.1 (conservative) |
| **Sequences per backbone** | 8 |
| **Total sequences** | 32 |
### 3.2 Designed Sequences (Top 10 by Score)
| Rank | Backbone | Sequence ID | Length | MPNN Score | Predicted pI |
|------|----------|-------------|--------|------------|--------------|
| 1 | BB_001 | Seq_001_A | 85 | -1.89 | 6.2 |
| 2 | BB_002 | Seq_002_C | 92 | -1.95 | 5.8 |
| 3 | BB_001 | Seq_001_B | 85 | -2.01 | 7.1 |
| 4 | BB_003 | Seq_003_A | 78 | -2.08 | 6.5 |
| 5 | BB_005 | Seq_005_B | 95 | -2.12 | 5.4 |
### 3.3 Top Sequence: Seq_001_A
Seq_001_A (85 aa, MPNN score: -1.89) MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSH GSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKL
*Source: NVIDIA NIM via `NvidiaNIM_proteinmpnn`*def validate_structure(tu, sequence):
"""Validate designed sequence by structure prediction."""
# Fast validation with ESMFold
predicted = tu.tools.NvidiaNIM_esmfold(sequence=sequence)
# Extract quality metrics
plddt = extract_plddt(predicted)
ptm = extract_ptm(predicted)
return {
'structure': predicted,
'mean_plddt': np.mean(plddt),
'ptm': ptm,
'passes': np.mean(plddt) > 70 and ptm > 0.7
}| Metric | Threshold | Interpretation |
|---|---|---|
| Mean pLDDT | >70 | Confident fold |
| pTM | >0.7 | Good global topology |
| RMSD to backbone | <2 Å | Design recapitulated |
## 4. Structure Validation
### 4.1 Validation Results
| Sequence | pLDDT | pTM | RMSD to Design | Status |
|----------|-------|-----|----------------|--------|
| Seq_001_A | 88.5 | 0.85 | 1.2 Å | ✓ PASS |
| Seq_002_C | 82.3 | 0.79 | 1.5 Å | ✓ PASS |
| Seq_001_B | 85.1 | 0.82 | 1.3 Å | ✓ PASS |
| Seq_003_A | 79.8 | 0.76 | 1.8 Å | ✓ PASS |
| Seq_005_B | 68.2 | 0.65 | 2.8 Å | ✗ FAIL |
### 4.2 Top Validated Design: Seq_001_A
| Region | Residues | pLDDT | Interpretation |
|--------|----------|-------|----------------|
| Helix 1 | 1-28 | 92.3 | Very high confidence |
| Loop 1 | 29-35 | 78.4 | Moderate confidence |
| Helix 2 | 36-58 | 91.8 | Very high confidence |
| Loop 2 | 59-65 | 75.2 | Moderate confidence |
| Helix 3 | 66-85 | 90.1 | Very high confidence |
**Overall**: Well-folded 3-helix bundle with high confidence core
*Source: NVIDIA NIM via `NvidiaNIM_esmfold`*def assess_aggregation(sequence):
"""Assess aggregation propensity."""
# Calculate hydrophobic patches
# Calculate isoelectric point
# Identify aggregation-prone motifs
return {
'aggregation_score': score,
'hydrophobic_patches': patches,
'risk_level': 'Low' if score < 0.5 else 'Medium' if score < 0.7 else 'High'
}| Metric | Favorable | Marginal | Unfavorable |
|---|---|---|---|
| Aggregation score | <0.5 | 0.5-0.7 | >0.7 |
| Isoelectric point | 5-9 | 4-5 or 9-10 | <4 or >10 |
| Hydrophobic patches | <3 | 3-5 | >5 |
| Cysteine count | 0 or even | Odd | Multiple unpaired |
## 5. Developability Assessment
### 5.1 Developability Scores
| Design | Aggregation | pI | Cysteines | Expression | Overall |
|--------|-------------|-----|-----------|------------|---------|
| Seq_001_A | 0.32 (Low) | 6.2 | 0 | High | ★★★ |
| Seq_002_C | 0.45 (Low) | 5.8 | 2 (paired) | Medium | ★★☆ |
| Seq_001_B | 0.38 (Low) | 7.1 | 0 | High | ★★★ |
| Seq_003_A | 0.58 (Med) | 6.5 | 0 | Medium | ★★☆ |
### 5.2 Recommendations
**Best candidate for expression**: Seq_001_A
- Low aggregation propensity
- Neutral pI (easy purification)
- No cysteines (no misfolding risk)
- Predicted high E. coli expression
*Source: Sequence analysis*# Therapeutic Protein Design Report: [TARGET]
**Generated**: [Date] | **Query**: [Original query] | **Status**: In Progress
---
## Executive Summary
[Designing...]
---
## 1. Target Characterization
### 1.1 Target Information
[Designing...]
### 1.2 Binding Epitope
[Designing...]
---
## 2. Backbone Generation
### 2.1 Design Parameters
[Designing...]
### 2.2 Generated Backbones
[Designing...]
---
## 3. Sequence Design
### 3.1 ProteinMPNN Results
[Designing...]
### 3.2 Top Sequences
[Designing...]
---
## 4. Structure Validation
### 4.1 ESMFold Validation
[Designing...]
### 4.2 Quality Metrics
[Designing...]
---
## 5. Developability Assessment
### 5.1 Scores
[Designing...]
### 5.2 Recommendations
[Designing...]
---
## 6. Final Candidates
### 6.1 Ranked List
[Designing...]
### 6.2 Sequences for Testing
[Designing...]
---
## 7. Experimental Recommendations
[Designing...]
---
## 8. Data Sources
[Will be populated...]| Tier | Symbol | Criteria |
|---|---|---|
| T1 | ★★★ | pLDDT >85, pTM >0.8, low aggregation, neutral pI |
| T2 | ★★☆ | pLDDT >75, pTM >0.7, acceptable developability |
| T3 | ★☆☆ | pLDDT >70, pTM >0.65, developability concerns |
| T4 | ☆☆☆ | Failed validation or major developability issues |
| Primary Tool | Fallback 1 | Fallback 2 |
|---|---|---|
| Manual backbone design | Scaffold from PDB |
| Rosetta ProteinMPNN | Manual sequence design |
| | AlphaFold DB |
| PDB structure | | AlphaFold DB |